PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn311681
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 51aa    MW: 5548.54 Da    PI: 9.9525
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn311681genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.62.1e-111344132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     +g+WT+eEd++l+ +++++G g+W++ + + g
       Achn311681 13 KGPWTPEEDQKLLAYIEEHGHGSWRALPVKAG 44
                     79***********************9887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.882850IPR017930Myb domain
SuperFamilySSF466891.86E-91141IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-141146IPR009057Homeodomain-like
PfamPF002491.0E-91340IPR001005SANT/Myb domain
CDDcd001676.50E-71546No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 51 aa     Download sequence    Send to blast
MVVVHGLGLV IKKGPWTPEE DQKLLAYIEE HGHGSWRALP VKAGVRVAFK *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002311313.21e-18hypothetical protein POPTR_0008s08920g
SwissprotQ7XBH41e-12MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLB9HI921e-18B9HI92_POPTR; Uncharacterized protein
STRINGPOPTR_0008s08920.13e-18(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2162222
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.15e-20myb domain protein 106